Lineage for d2d7th_ (2d7t H:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1083 PDB entries)
  8. 2355426Domain d2d7th_: 2d7t H: [203941]
    Other proteins in same PDB: d2d7tl1, d2d7tl2
    automated match to d4jvpa_

Details for d2d7th_

PDB Entry: 2d7t (more details), 1.7 Å

PDB Description: Crystal structure of human anti polyhydroxybutyrate antibody Fv
PDB Compounds: (H:) anti polyhydroxybutyrate antibody Fv, heavy chain

SCOPe Domain Sequences for d2d7th_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7th_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgasvkvsckasgytftgnymhwvrqapgqgleymgwinpksgdtny
aqkfqgrvtmtrdtsistvymevrrlrsddtavyycatgwwgmdvwgqgtlvtvss

SCOPe Domain Coordinates for d2d7th_:

Click to download the PDB-style file with coordinates for d2d7th_.
(The format of our PDB-style files is described here.)

Timeline for d2d7th_: