Lineage for d2d74b2 (2d74 B:104-139)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643023Fold g.59: Zinc-binding domain of translation initiation factor 2 beta [75688] (1 superfamily)
    zinc-bound beta-ribbon motif
  4. 2643024Superfamily g.59.1: Zinc-binding domain of translation initiation factor 2 beta [75689] (2 families) (S)
  5. 2643031Family g.59.1.0: automated matches [227177] (1 protein)
    not a true family
  6. 2643032Protein automated matches [226894] (1 species)
    not a true protein
  7. 2643033Species Pyrococcus furiosus [TaxId:186497] [225101] (1 PDB entry)
  8. 2643034Domain d2d74b2: 2d74 B:104-139 [203939]
    Other proteins in same PDB: d2d74b1
    automated match to d1neea2
    complexed with zn

Details for d2d74b2

PDB Entry: 2d74 (more details), 2.8 Å

PDB Description: crystal structure of translation initiation factor aif2betagamma heterodimer
PDB Compounds: (B:) Translation initiation factor 2 beta subunit

SCOPe Domain Sequences for d2d74b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d74b2 g.59.1.0 (B:104-139) automated matches {Pyrococcus furiosus [TaxId: 186497]}
yvicpvcgspdtkiikrdrfhflkceacgaetpiqh

SCOPe Domain Coordinates for d2d74b2:

Click to download the PDB-style file with coordinates for d2d74b2.
(The format of our PDB-style files is described here.)

Timeline for d2d74b2: