![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.59: Zinc-binding domain of translation initiation factor 2 beta [75688] (1 superfamily) zinc-bound beta-ribbon motif |
![]() | Superfamily g.59.1: Zinc-binding domain of translation initiation factor 2 beta [75689] (2 families) ![]() |
![]() | Family g.59.1.0: automated matches [227177] (1 protein) not a true family |
![]() | Protein automated matches [226894] (1 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:186497] [225101] (1 PDB entry) |
![]() | Domain d2d74b2: 2d74 B:104-139 [203939] Other proteins in same PDB: d2d74b1 automated match to d1neea2 complexed with zn |
PDB Entry: 2d74 (more details), 2.8 Å
SCOPe Domain Sequences for d2d74b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d74b2 g.59.1.0 (B:104-139) automated matches {Pyrococcus furiosus [TaxId: 186497]} yvicpvcgspdtkiikrdrfhflkceacgaetpiqh
Timeline for d2d74b2: