SCOPe 2.03: Domain d2d74b2: 2d74 B:104-139

Lineage for d2d74b2 (2d74 B:104-139)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.59: Zinc-binding domain of translation initiation factor 2 beta [75688] (1 superfamily)
   zinc-bound beta-ribbon motif

4. Superfamily g.59.1: Zinc-binding domain of translation initiation factor 2 beta [75689] (2 families)

5. Family g.59.1.0: automated matches [227177] (1 protein)
   not a true family

6. Protein automated matches [226894] (1 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [225101] (1 PDB entry)

8. Domain d2d74b2: 2d74 B:104-139 [203939]
   Other proteins in same PDB: d2d74b1
   automated match to d1neea2
   complexed with zn

Details for d2d74b2

PDB Entry: 2d74, 2.8 Å

PDB Description: crystal structure of translation initiation factor aif2betagamma heterodimer

PDB Compounds: (B:) Translation initiation factor 2 beta subunit

SCOPe Domain Sequences for d2d74b2:

Sequence; same for both SEQRES and ATOM records:

>d2d74b2 g.59.1.0 (B:104-139) automated matches {Pyrococcus furiosus [TaxId: 186497]}
yvicpvcgspdtkiikrdrfhflkceacgaetpiqh

Timeline for d2d74b2:

• d2d74b2 is new in SCOPe 2.03-stable
  
• d2d74b2 appears in SCOPe 2.04
  
• d2d74b2 appears in the current release, SCOPe 2.08