![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies) beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e |
![]() | Superfamily d.241.1: Translation initiation factor 2 beta, aIF2beta, N-terminal domain [100966] (2 families) ![]() |
![]() | Family d.241.1.0: automated matches [227176] (1 protein) not a true family |
![]() | Protein automated matches [226893] (1 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:186497] [225100] (1 PDB entry) |
![]() | Domain d2d74b1: 2d74 B:3-103 [203938] Other proteins in same PDB: d2d74b2 automated match to d1neea1 complexed with zn |
PDB Entry: 2d74 (more details), 2.8 Å
SCOPe Domain Sequences for d2d74b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d74b1 d.241.1.0 (B:3-103) automated matches {Pyrococcus furiosus [TaxId: 186497]} idyydyekllekayqelpenvkhhksrfevpgalvtiegnktiienfkdiadalnrdpqh llkfllreiatagtlegrrvvlqgrftpylianklkkyike
Timeline for d2d74b1: