SCOPe 2.08: Domain d2d74b1: 2d74 B:3-103

Lineage for d2d74b1 (2d74 B:3-103)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies)
   beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e

4. Superfamily d.241.1: Translation initiation factor 2 beta, aIF2beta, N-terminal domain [100966] (2 families)

5. Family d.241.1.0: automated matches [227176] (1 protein)
   not a true family

6. Protein automated matches [226893] (1 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [225100] (1 PDB entry)

8. Domain d2d74b1: 2d74 B:3-103 [203938]
   Other proteins in same PDB: d2d74b2
   automated match to d1neea1
   complexed with zn

Details for d2d74b1

PDB Entry: 2d74, 2.8 Å

PDB Description: crystal structure of translation initiation factor aif2betagamma heterodimer

PDB Compounds: (B:) Translation initiation factor 2 beta subunit

SCOPe Domain Sequences for d2d74b1:

Sequence; same for both SEQRES and ATOM records:

>d2d74b1 d.241.1.0 (B:3-103) automated matches {Pyrococcus furiosus [TaxId: 186497]}
idyydyekllekayqelpenvkhhksrfevpgalvtiegnktiienfkdiadalnrdpqh
llkfllreiatagtlegrrvvlqgrftpylianklkkyike

Timeline for d2d74b1:

• d2d74b1 first appeared in SCOPe 2.03
  
• d2d74b1 appears in SCOPe 2.07