SCOPe 2.05: Domain d2d5fb2: 2d5f B:326-493

Lineage for d2d5fb2 (2d5f B:326-493)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (20 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [225175] (2 PDB entries)

8. Domain d2d5fb2: 2d5f B:326-493 [203925]
   automated match to d1fxza2
   complexed with co3, mg

Details for d2d5fb2

PDB Entry: 2d5f, 1.9 Å

PDB Description: Crystal Structure of Recombinant Soybean Proglycinin A3B4 subunit, its Comparison with Mature Glycinin A3B4 subunit, Responsible for Hexamer Assembly

PDB Compounds: (B:) glycinin A3B4 subunit

SCOPe Domain Sequences for d2d5fb2:

Sequence; same for both SEQRES and ATOM records:

>d2d5fb2 b.82.1.0 (B:326-493) automated matches {Soybean (Glycine max) [TaxId: 3847]}
ictmklheniarpsradfynpkagristlnsltlpalrqfglsaqyvvlyrngiysphwn
lnansviyvtrgkgrvrvvncqgnavfdgelrrgqllvvpqnfvvaeqggeqgleyvvfk
thhnavssyikdvfraipsevlsnsynlgqsqvrqlkyqgnsgplvnp

Timeline for d2d5fb2:

• d2d5fb2 first appeared in SCOPe 2.03
  
• d2d5fb2 appears in SCOPe 2.04
  
• d2d5fb2 appears in SCOPe 2.06
  
• d2d5fb2 appears in the current release, SCOPe 2.08