SCOPe 2.08: Domain d2d52b1: 2d52 B:11-248

Lineage for d2d52b1 (2d52 B:11-248)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Aloe arborescens [TaxId:45385] [225155] (3 PDB entries)

8. Domain d2d52b1: 2d52 B:11-248 [203920]
   Other proteins in same PDB: d2d52a3
   automated match to d1cmla1
   complexed with coa; mutant

Details for d2d52b1

PDB Entry: 2d52, 1.6 Å

PDB Description: pentaketide chromone synthase (m207g mutant complexed with coa)

PDB Compounds: (B:) pentaketide chromone synthase

SCOPe Domain Sequences for d2d52b1:

Sequence; same for both SEQRES and ATOM records:

>d2d52b1 c.95.1.0 (B:11-248) automated matches {Aloe arborescens [TaxId: 45385]}
lplmedvqgirkaqkadgtatvmaigtahpphifpqdtyadvyfratnsehkvelkkkfd
hickktmigkryfnydeeflkkypnitsydepslndrqdicvpgvpalgteaavkaieew
grpkseithlvfctscgvdmpsadfqcakllglhanvnkyciymqgcyaggtvmryakdl
aennrgarvlvvcaeltimglrapnethldnaigislfgdgaaaliigsdpiigvekp

Timeline for d2d52b1:

• d2d52b1 first appeared in SCOPe 2.03
  
• d2d52b1 appears in SCOPe 2.07