Lineage for d2d51b2 (2d51 B:249-405)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917352Species Aloe arborescens [TaxId:45385] [225155] (3 PDB entries)
  8. 2917356Domain d2d51b2: 2d51 B:249-405 [203917]
    Other proteins in same PDB: d2d51a3
    automated match to d1bi5a2
    mutant

Details for d2d51b2

PDB Entry: 2d51 (more details), 1.6 Å

PDB Description: pentaketide chromone synthase (m207g mutant)
PDB Compounds: (B:) pentaketide chromone synthase

SCOPe Domain Sequences for d2d51b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d51b2 c.95.1.0 (B:249-405) automated matches {Aloe arborescens [TaxId: 45385]}
mfeivctkqtvipntedvihlhlretgmmfylskgspmtisnnveaclidvfksvgitpp
edwnslfwiphpggraildqveaklklrpekfraartvlwdygnmvsasvgyildemrrk
saakgletygeglewgvllgfgpgitvetillhslpl

SCOPe Domain Coordinates for d2d51b2:

Click to download the PDB-style file with coordinates for d2d51b2.
(The format of our PDB-style files is described here.)

Timeline for d2d51b2: