Lineage for d2d51b1 (2d51 B:11-248)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2524619Species Aloe arborescens [TaxId:45385] [225155] (3 PDB entries)
  8. 2524622Domain d2d51b1: 2d51 B:11-248 [203916]
    Other proteins in same PDB: d2d51a3
    automated match to d1cmla1
    mutant

Details for d2d51b1

PDB Entry: 2d51 (more details), 1.6 Å

PDB Description: pentaketide chromone synthase (m207g mutant)
PDB Compounds: (B:) pentaketide chromone synthase

SCOPe Domain Sequences for d2d51b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d51b1 c.95.1.0 (B:11-248) automated matches {Aloe arborescens [TaxId: 45385]}
lplmedvqgirkaqkadgtatvmaigtahpphifpqdtyadvyfratnsehkvelkkkfd
hickktmigkryfnydeeflkkypnitsydepslndrqdicvpgvpalgteaavkaieew
grpkseithlvfctscgvdmpsadfqcakllglhanvnkyciymqgcyaggtvmryakdl
aennrgarvlvvcaeltimglrapnethldnaigislfgdgaaaliigsdpiigvekp

SCOPe Domain Coordinates for d2d51b1:

Click to download the PDB-style file with coordinates for d2d51b1.
(The format of our PDB-style files is described here.)

Timeline for d2d51b1: