Lineage for d2d4wb1 (2d4w B:2-254)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2884891Species Cellulomonas sp. [TaxId:40001] [225172] (1 PDB entry)
  8. 2884894Domain d2d4wb1: 2d4w B:2-254 [203912]
    automated match to d1glfo1
    complexed with mpd

Details for d2d4wb1

PDB Entry: 2d4w (more details), 2.3 Å

PDB Description: Crystal structure of glycerol kinase from Cellulomonas sp. NT3060
PDB Compounds: (B:) glycerol kinase

SCOPe Domain Sequences for d2d4wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d4wb1 c.55.1.0 (B:2-254) automated matches {Cellulomonas sp. [TaxId: 40001]}
adyvlaidqgttssraivfdhsgeiystgqlehdqifpragwvehnpeqiwnnvrevvgl
altrgnlthediaavgitnqretavvwdkttgkpvynaivwqdtrtqkivdelggdegae
kyksivglplatyfsgpkikwildnvegarekaekgdllfgntdtwvlwnmtggteggvh
vtdvtnasrtmlmdldtlswrediaadmgiplsmlpdirsssevyghgrprglvpgvpia
gilgdqqaatfgq

SCOPe Domain Coordinates for d2d4wb1:

Click to download the PDB-style file with coordinates for d2d4wb1.
(The format of our PDB-style files is described here.)

Timeline for d2d4wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d4wb2