Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (35 species) not a true protein |
Species Cellulomonas sp. [TaxId:40001] [225172] (1 PDB entry) |
Domain d2d4wa1: 2d4w A:2-254 [203910] automated match to d1glfo1 complexed with mpd |
PDB Entry: 2d4w (more details), 2.3 Å
SCOPe Domain Sequences for d2d4wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4wa1 c.55.1.0 (A:2-254) automated matches {Cellulomonas sp. [TaxId: 40001]} adyvlaidqgttssraivfdhsgeiystgqlehdqifpragwvehnpeqiwnnvrevvgl altrgnlthediaavgitnqretavvwdkttgkpvynaivwqdtrtqkivdelggdegae kyksivglplatyfsgpkikwildnvegarekaekgdllfgntdtwvlwnmtggteggvh vtdvtnasrtmlmdldtlswrediaadmgiplsmlpdirsssevyghgrprglvpgvpia gilgdqqaatfgq
Timeline for d2d4wa1: