Lineage for d2d4na_ (2d4n A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1809317Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1809467Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1809660Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 1809661Protein automated matches [191182] (12 species)
    not a true protein
  7. 1809809Species Mason-pfizer monkey virus [TaxId:11855] [225168] (16 PDB entries)
  8. 1809811Domain d2d4na_: 2d4n A: [203909]
    automated match to d1q5hc_
    complexed with dup, mg, trs

Details for d2d4na_

PDB Entry: 2d4n (more details), 1.53 Å

PDB Description: crystal structure of m-pmv dutpase complexed with dupnpp, substrate analogue
PDB Compounds: (A:) du

SCOPe Domain Sequences for d2d4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d4na_ b.85.4.0 (A:) automated matches {Mason-pfizer monkey virus [TaxId: 11855]}
kqpiskltratpgsagldlcstshtvltpemgpqalstgiygplppntfglilgrssitm
kglqvypgvidndytgeikimakavnnivtvsqgnriaqlillplietdnkvq

SCOPe Domain Coordinates for d2d4na_:

Click to download the PDB-style file with coordinates for d2d4na_.
(The format of our PDB-style files is described here.)

Timeline for d2d4na_: