Lineage for d2d4ad2 (2d4a D:141-308)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939264Species Aeropyrum pernix [TaxId:56636] [225174] (1 PDB entry)
  8. 1939268Domain d2d4ad2: 2d4a D:141-308 [203906]
    Other proteins in same PDB: d2d4aa1, d2d4ab1, d2d4ac1, d2d4ad1
    automated match to d1guya2

Details for d2d4ad2

PDB Entry: 2d4a (more details), 2.87 Å

PDB Description: Structure of the malate dehydrogenase from Aeropyrum pernix
PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d2d4ad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d4ad2 d.162.1.0 (D:141-308) automated matches {Aeropyrum pernix [TaxId: 56636]}
sgildsarmayyisqklgvsfksvnaivlgmhgqkmfpvprlssvggvplehlmskeeie
evvsetvnagakitelrgyssnygpaaglvltveaikrdskriypyslylqgeygyndiv
aevpavigksgieriielpltedekrkfdeavqavkklvetlppqlre

SCOPe Domain Coordinates for d2d4ad2:

Click to download the PDB-style file with coordinates for d2d4ad2.
(The format of our PDB-style files is described here.)

Timeline for d2d4ad2: