Lineage for d2d4ac1 (2d4a C:1-140)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (217 species)
    not a true protein
  7. 2094290Species Aeropyrum pernix [TaxId:56636] [225173] (1 PDB entry)
  8. 2094293Domain d2d4ac1: 2d4a C:1-140 [203903]
    Other proteins in same PDB: d2d4aa2, d2d4ab2, d2d4ac2, d2d4ad2
    automated match to d1guya1

Details for d2d4ac1

PDB Entry: 2d4a (more details), 2.87 Å

PDB Description: Structure of the malate dehydrogenase from Aeropyrum pernix
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d2d4ac1:

Sequence, based on SEQRES records: (download)

>d2d4ac1 c.2.1.0 (C:1-140) automated matches {Aeropyrum pernix [TaxId: 56636]}
mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
syedmrgsdivlvtagigrkpgmtreqlleanantmadlaekikayakdaivvittnpvd
amtyvmykktgfprervigf

Sequence, based on observed residues (ATOM records): (download)

>d2d4ac1 c.2.1.0 (C:1-140) automated matches {Aeropyrum pernix [TaxId: 56636]}
mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
syedmrgsdivlvtagigrkleanantmadlaekikayakdaivvittnpvdamtyvmyk
ktgfprervigf

SCOPe Domain Coordinates for d2d4ac1:

Click to download the PDB-style file with coordinates for d2d4ac1.
(The format of our PDB-style files is described here.)

Timeline for d2d4ac1: