SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2d4ac1 (2d4a C:1-140)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (230 species)
    not a true protein
  7. 2094290Species Aeropyrum pernix [TaxId:56636] [225173] (1 PDB entry)
  8. 2094293Domain d2d4ac1: 2d4a C:1-140 [203903]
    Other proteins in same PDB: d2d4aa2, d2d4ab2, d2d4ac2, d2d4ad2
    automated match to d1guya1

Details for d2d4ac1

PDB Entry: 2d4a (more details), 2.87 Å

PDB Description: Structure of the malate dehydrogenase from Aeropyrum pernix
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d2d4ac1:

Sequence, based on SEQRES records: (download)

>d2d4ac1 c.2.1.0 (C:1-140) automated matches {Aeropyrum pernix [TaxId: 56636]}
mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
syedmrgsdivlvtagigrkpgmtreqlleanantmadlaekikayakdaivvittnpvd
amtyvmykktgfprervigf

Sequence, based on observed residues (ATOM records): (download)

>d2d4ac1 c.2.1.0 (C:1-140) automated matches {Aeropyrum pernix [TaxId: 56636]}
mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
syedmrgsdivlvtagigrkleanantmadlaekikayakdaivvittnpvdamtyvmyk
ktgfprervigf

SCOPe Domain Coordinates for d2d4ac1:

Click to download the PDB-style file with coordinates for d2d4ac1.
(The format of our PDB-style files is described here.)

Timeline for d2d4ac1: