Lineage for d2d3mb2 (2d3m B:249-405)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881785Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1881786Protein automated matches [196909] (52 species)
    not a true protein
  7. 1881787Species Aloe arborescens [TaxId:45385] [225155] (3 PDB entries)
  8. 1881799Domain d2d3mb2: 2d3m B:249-405 [203898]
    automated match to d1bi5a2
    complexed with coa

Details for d2d3mb2

PDB Entry: 2d3m (more details), 1.6 Å

PDB Description: Pentaketide chromone synthase complexed with coenzyme A
PDB Compounds: (B:) pentaketide chromone synthase

SCOPe Domain Sequences for d2d3mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3mb2 c.95.1.0 (B:249-405) automated matches {Aloe arborescens [TaxId: 45385]}
mfeivctkqtvipntedvihlhlretgmmfylskgspmtisnnveaclidvfksvgitpp
edwnslfwiphpggraildqveaklklrpekfraartvlwdygnmvsasvgyildemrrk
saakgletygeglewgvllgfgpgitvetillhslpl

SCOPe Domain Coordinates for d2d3mb2:

Click to download the PDB-style file with coordinates for d2d3mb2.
(The format of our PDB-style files is described here.)

Timeline for d2d3mb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d3mb1