SCOPe 2.06: Domain d2d37a1: 2d37 A:2-155

Lineage for d2d37a1 (2d37 A:2-155)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (20 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [225074] (3 PDB entries)

8. Domain d2d37a1: 2d37 A:2-155 [203890]
   Other proteins in same PDB: d2d37a2
   automated match to d1rz1a_
   complexed with fmn, nad

Details for d2d37a1

PDB Entry: 2d37, 1.7 Å

PDB Description: The Crystal Structure of Flavin Reductase HpaC complexed with NAD+

PDB Compounds: (A:) hypothetical NADH-dependent FMN oxidoreductase

SCOPe Domain Sequences for d2d37a1:

Sequence; same for both SEQRES and ATOM records:

>d2d37a1 b.45.1.0 (A:2-155) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
aeviksimrkfplgvaivttnwkgelvgmtvntfnslslnpplvsffadrmkgndipyke
skyfvvnftdneelfnifalkpvkerfreikykegiggcpilydsyayieaklydtidvg
dhsiivgevidgyqirdnftplvymnrkyyklss

Timeline for d2d37a1:

• d2d37a1 first appeared in SCOPe 2.03, called d2d37a_
  
• d2d37a1 was called d2d37a_ in SCOPe 2.05
  
• d2d37a1 appears in SCOPe 2.07
  
• d2d37a1 appears in the current release, SCOPe 2.08