Class b: All beta proteins [48724] (176 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (19 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:273063] [225074] (3 PDB entries) |
Domain d2d36a_: 2d36 A: [203889] automated match to d1rz1a_ complexed with fmn |
PDB Entry: 2d36 (more details), 2.3 Å
SCOPe Domain Sequences for d2d36a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d36a_ b.45.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]} maeviksimrkfplgvaivttnwkgelvgmtvntfnslslnpplvsffadrmkgndipyk eskyfvvnftdneelfnifalkpvkerfreikykegiggcpilydsyayieaklydtidv gdhsiivgevidgyqirdnftplvymnrkyykls
Timeline for d2d36a_: