SCOPe 2.05: Domain d2d36a_: 2d36 A:

Lineage for d2d36a_ (2d36 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (19 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [225074] (3 PDB entries)

8. Domain d2d36a_: 2d36 A: [203889]
   automated match to d1rz1a_
   complexed with fmn

Details for d2d36a_

PDB Entry: 2d36, 2.3 Å

PDB Description: The Crystal Structure of Flavin Reductase HpaC

PDB Compounds: (A:) hypothetical NADH-dependent FMN oxidoreductase

SCOPe Domain Sequences for d2d36a_:

Sequence; same for both SEQRES and ATOM records:

>d2d36a_ b.45.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
maeviksimrkfplgvaivttnwkgelvgmtvntfnslslnpplvsffadrmkgndipyk
eskyfvvnftdneelfnifalkpvkerfreikykegiggcpilydsyayieaklydtidv
gdhsiivgevidgyqirdnftplvymnrkyykls

Timeline for d2d36a_:

• d2d36a_ first appeared in SCOPe 2.03
  
• d2d36a_ appears in SCOPe 2.04
  
• d2d36a_ is called d2d36a1 in SCOPe 2.06
  
• d2d36a_ appears in the current release, SCOPe 2.08, called d2d36a1