Lineage for d2d2zc2 (2d2z C:103-253)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714013Species Human (Homo sapiens) [TaxId:9606] [225003] (13 PDB entries)
  8. 2714039Domain d2d2zc2: 2d2z C:103-253 [203888]
    Other proteins in same PDB: d2d2za1, d2d2zb1, d2d2zc1, d2d2zc3
    automated match to d1k0ma1

Details for d2d2zc2

PDB Entry: 2d2z (more details), 2.2 Å

PDB Description: crystal structure of soluble form of clic4
PDB Compounds: (C:) Chloride intracellular channel protein 4

SCOPe Domain Sequences for d2d2zc2:

Sequence, based on SEQRES records: (download)

>d2d2zc2 a.45.1.0 (C:103-253) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kylklspkhpesntagmdifakfsayiknsrpeanealergllktlqkldeylnsplpde
idensmedikfstrkfldgnemtladcnllpklhivkvvakkyrnfdipkemtgiwrylt
naysrdeftntcpsdkeveiaysdvakrltk

Sequence, based on observed residues (ATOM records): (download)

>d2d2zc2 a.45.1.0 (C:103-253) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kylklspkhpesntagmdifakfsayiknsrpeanealergllktlqkldeylnsplpfs
trkfldgnemtladcnllpklhivkvvakkyrnfdipkemtgiwryltnaysrdeftntc
psdkeveiaysdvakrltk

SCOPe Domain Coordinates for d2d2zc2:

Click to download the PDB-style file with coordinates for d2d2zc2.
(The format of our PDB-style files is described here.)

Timeline for d2d2zc2: