Lineage for d2d2zc1 (2d2z C:13-102)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879614Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2879848Domain d2d2zc1: 2d2z C:13-102 [203887]
    Other proteins in same PDB: d2d2za2, d2d2zb2, d2d2zc2, d2d2zc3
    automated match to d1k0ma2

Details for d2d2zc1

PDB Entry: 2d2z (more details), 2.2 Å

PDB Description: crystal structure of soluble form of clic4
PDB Compounds: (C:) Chloride intracellular channel protein 4

SCOPe Domain Sequences for d2d2zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2zc1 c.47.1.0 (C:13-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edkeplielfvkagsdgesigncpfsqrlfmilwlkgvvfsvttvdlkrkpadlqnlapg
thppfitfnsevktdvnkieefleevlcpp

SCOPe Domain Coordinates for d2d2zc1:

Click to download the PDB-style file with coordinates for d2d2zc1.
(The format of our PDB-style files is described here.)

Timeline for d2d2zc1: