SCOPe 2.07: Domain d2d2zb2: 2d2z B:103-253

Lineage for d2d2zb2 (2d2z B:103-253)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225003] (13 PDB entries)

8. Domain d2d2zb2: 2d2z B:103-253 [203886]
   Other proteins in same PDB: d2d2za1, d2d2zb1, d2d2zc1, d2d2zc3
   automated match to d1k0ma1

Details for d2d2zb2

PDB Entry: 2d2z, 2.2 Å

PDB Description: crystal structure of soluble form of clic4

PDB Compounds: (B:) Chloride intracellular channel protein 4

SCOPe Domain Sequences for d2d2zb2:

Sequence, based on SEQRES records:

>d2d2zb2 a.45.1.0 (B:103-253) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kylklspkhpesntagmdifakfsayiknsrpeanealergllktlqkldeylnsplpde
idensmedikfstrkfldgnemtladcnllpklhivkvvakkyrnfdipkemtgiwrylt
naysrdeftntcpsdkeveiaysdvakrltk

Sequence, based on observed residues (ATOM records):

>d2d2zb2 a.45.1.0 (B:103-253) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kylklspkhpesntagmdifakfsayiknsrpeanealergllktlqkldeylnsplpde
ikfstrkfldgnemtladcnllpklhivkvvakkyrnfdipkemtgiwryltnaysrdef
tntcpsdkeveiaysdvakrltk

Timeline for d2d2zb2:

• d2d2zb2 first appeared in SCOPe 2.03
  
• d2d2zb2 appears in SCOPe 2.06
  
• d2d2zb2 appears in the current release, SCOPe 2.08