SCOPe 2.03: Domain d2d2zb1: 2d2z B:6-102

Lineage for d2d2zb1 (2d2z B:6-102)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries)

8. Domain d2d2zb1: 2d2z B:6-102 [203885]
   Other proteins in same PDB: d2d2za2, d2d2zb2, d2d2zc2
   automated match to d1k0ma2

Details for d2d2zb1

PDB Entry: 2d2z, 2.2 Å

PDB Description: crystal structure of soluble form of clic4

PDB Compounds: (B:) Chloride intracellular channel protein 4

SCOPe Domain Sequences for d2d2zb1:

Sequence; same for both SEQRES and ATOM records:

>d2d2zb1 c.47.1.0 (B:6-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plnglkeedkeplielfvkagsdgesigncpfsqrlfmilwlkgvvfsvttvdlkrkpad
lqnlapgthppfitfnsevktdvnkieefleevlcpp

Timeline for d2d2zb1:

• d2d2zb1 is new in SCOPe 2.03-stable
  
• d2d2zb1 appears in SCOPe 2.04
  
• d2d2zb1 appears in the current release, SCOPe 2.08