![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225003] (13 PDB entries) |
![]() | Domain d2d2za2: 2d2z A:103-253 [203884] Other proteins in same PDB: d2d2za1, d2d2zb1, d2d2zc1, d2d2zc3 automated match to d1k0ma1 |
PDB Entry: 2d2z (more details), 2.2 Å
SCOPe Domain Sequences for d2d2za2:
Sequence, based on SEQRES records: (download)
>d2d2za2 a.45.1.0 (A:103-253) automated matches {Human (Homo sapiens) [TaxId: 9606]} kylklspkhpesntagmdifakfsayiknsrpeanealergllktlqkldeylnsplpde idensmedikfstrkfldgnemtladcnllpklhivkvvakkyrnfdipkemtgiwrylt naysrdeftntcpsdkeveiaysdvakrltk
>d2d2za2 a.45.1.0 (A:103-253) automated matches {Human (Homo sapiens) [TaxId: 9606]} kylklspkhpesntagmdifakfsayiknsrpeanealergllktlqkldeylnsplpkf strkfldgnemtladcnllpklhivkvvakkyrnfdipkemtgiwryltnaysrdeftnt cpsdkeveiaysdvakrltk
Timeline for d2d2za2: