SCOPe 2.08: Domain d2d22b1: 2d22 B:501-801

Lineage for d2d22b1 (2d22 B:501-801)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (28 species)
   not a true protein

7. Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (10 PDB entries)

8. Domain d2d22b1: 2d22 B:501-801 [203871]
   Other proteins in same PDB: d2d22a2, d2d22b2
   automated match to d1xyfa2
   complexed with gol, so4; mutant

Details for d2d22b1

PDB Entry: 2d22, 1.7 Å

PDB Description: crystal structure of covalent glycosyl-enzyme intermediate of catalytic-site mutant xylanase from streptomyces olivaceoviridis e-86

PDB Compounds: (B:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d2d22b1:

Sequence; same for both SEQRES and ATOM records:

>d2d22b1 c.1.8.3 (B:501-801) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvshafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
n

Timeline for d2d22b1:

• d2d22b1 first appeared in SCOPe 2.03
  
• d2d22b1 appears in SCOPe 2.07