Lineage for d2d22a1 (2d22 A:1-301)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094316Protein automated matches [190057] (26 species)
    not a true protein
  7. 2094421Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (10 PDB entries)
  8. 2094424Domain d2d22a1: 2d22 A:1-301 [203869]
    Other proteins in same PDB: d2d22a2, d2d22b2
    automated match to d1xyfa2
    complexed with gol, so4; mutant

Details for d2d22a1

PDB Entry: 2d22 (more details), 1.7 Å

PDB Description: crystal structure of covalent glycosyl-enzyme intermediate of catalytic-site mutant xylanase from streptomyces olivaceoviridis e-86
PDB Compounds: (A:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d2d22a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d22a1 c.1.8.3 (A:1-301) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvshafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
n

SCOPe Domain Coordinates for d2d22a1:

Click to download the PDB-style file with coordinates for d2d22a1.
(The format of our PDB-style files is described here.)

Timeline for d2d22a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d22a2