SCOPe 2.03: Domain d2d20b2: 2d20 B:822-936

Lineage for d2d20b2 (2d20 B:822-936)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (4 species)
   not a true protein

7. Species Streptomyces olivaceoviridis [TaxId:1921] [225151] (5 PDB entries)

8. Domain d2d20b2: 2d20 B:822-936 [203868]
   Other proteins in same PDB: d2d20a1, d2d20b1
   automated match to d1xyfa1
   complexed with gol, npo; mutant

Details for d2d20b2

PDB Entry: 2d20, 1.85 Å

PDB Description: crystal structure of michaelis complex of catalytic-site mutant xylanase from streptomyces olivaceoviridis e-86

PDB Compounds: (B:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d2d20b2:

Sequence; same for both SEQRES and ATOM records:

>d2d20b2 b.42.2.0 (B:822-936) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
rcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtgngtkvqiys
cwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqrwtrt

Timeline for d2d20b2:

• d2d20b2 is new in SCOPe 2.03-stable
  
• d2d20b2 appears in SCOPe 2.04
  
• d2d20b2 appears in the current release, SCOPe 2.08