SCOPe 2.06: Domain d2d1zb2: 2d1z B:822-936

Lineage for d2d1zb2 (2d1z B:822-936)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Streptomyces olivaceoviridis [TaxId:1921] [225151] (7 PDB entries)

8. Domain d2d1zb2: 2d1z B:822-936 [203864]
   Other proteins in same PDB: d2d1za1, d2d1zb1
   automated match to d1xyfa1
   complexed with gol, so4; mutant

Details for d2d1zb2

PDB Entry: 2d1z, 1.6 Å

PDB Description: Crystal structure of catalytic-site mutant xylanase from Streptomyces olivaceoviridis E-86

PDB Compounds: (B:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d2d1zb2:

Sequence; same for both SEQRES and ATOM records:

>d2d1zb2 b.42.2.0 (B:822-936) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
rcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtgngtkvqiys
cwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqrwtrt

Timeline for d2d1zb2:

• d2d1zb2 first appeared in SCOPe 2.03
  
• d2d1zb2 appears in SCOPe 2.05
  
• d2d1zb2 appears in SCOPe 2.07
  
• d2d1zb2 appears in the current release, SCOPe 2.08