Lineage for d2d1za2 (2d1z A:322-436)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1316646Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1316851Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 1316852Protein automated matches [226913] (4 species)
    not a true protein
  7. 1316873Species Streptomyces olivaceoviridis [TaxId:1921] [225151] (5 PDB entries)
  8. 1316874Domain d2d1za2: 2d1z A:322-436 [203862]
    Other proteins in same PDB: d2d1za1, d2d1zb1
    automated match to d1xyfa1
    complexed with gol, so4; mutant

Details for d2d1za2

PDB Entry: 2d1z (more details), 1.6 Å

PDB Description: Crystal structure of catalytic-site mutant xylanase from Streptomyces olivaceoviridis E-86
PDB Compounds: (A:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d2d1za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1za2 b.42.2.0 (A:322-436) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
rcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtgngtkvqiys
cwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqrwtrt

SCOPe Domain Coordinates for d2d1za2:

Click to download the PDB-style file with coordinates for d2d1za2.
(The format of our PDB-style files is described here.)

Timeline for d2d1za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d1za1