SCOPe 2.05: Domain d2d1va_: 2d1v A:

Lineage for d2d1va_ (2d1v A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (14 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225130] (3 PDB entries)

8. Domain d2d1va_: 2d1v A: [203860]
   automated match to d1gxqa_

Details for d2d1va_

PDB Entry: 2d1v, 2.4 Å

PDB Description: crystal structure of dna-binding domain of bacillus subtilis yycf

PDB Compounds: (A:) Transcriptional regulatory protein yycF

SCOPe Domain Sequences for d2d1va_:

Sequence; same for both SEQRES and ATOM records:

>d2d1va_ a.4.6.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
ssneihigslvifpdayvvskrdetielthrefellhylakhigqvmtrehllqtvwgyd
yfgdvrtvdvtvrrlrekiednpshpnwivtrrgvgyylrnpe

Timeline for d2d1va_:

• d2d1va_ first appeared in SCOPe 2.03
  
• d2d1va_ appears in SCOPe 2.04
  
• d2d1va_ appears in SCOPe 2.06
  
• d2d1va_ appears in the current release, SCOPe 2.08