SCOPe 2.03: Domain d2czub_: 2czu B:

Lineage for d2czub_ (2czu B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225136] (2 PDB entries)

8. Domain d2czub_: 2czu B: [203859]
   automated match to d1gm6a_

Details for d2czub_

PDB Entry: 2czu, 2.1 Å

PDB Description: lipocalin-type prostaglandin d synthase

PDB Compounds: (B:) Prostaglandin-H2 D-isomerase

SCOPe Domain Sequences for d2czub_:

Sequence; same for both SEQRES and ATOM records:

>d2czub_ b.60.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qqdkflgrwysaglasnsswfrekkavlymaktvvapstegglnltstflrknqcetkim
vlqpagapghytyssphsgsihsvsvveanydeyallfsrgtkgpgqdfrmatlysrtqt
lkdelkekfttfskaqglteedivflpqpdkciqe

Timeline for d2czub_:

• d2czub_ is new in SCOPe 2.03-stable
  
• d2czub_ appears in SCOPe 2.04
  
• d2czub_ appears in the current release, SCOPe 2.08