| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein automated matches [226848] (14 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [225047] (2 PDB entries) |
| Domain d2cz3b2: 2cz3 B:88-215 [203851] Other proteins in same PDB: d2cz3a1, d2cz3b1 automated match to d1fw1a1 |
PDB Entry: 2cz3 (more details), 2.3 Å
SCOPe Domain Sequences for d2cz3b2:
Sequence, based on SEQRES records: (download)
>d2cz3b2 a.45.1.1 (B:88-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
llpqdpqkraivrmisdliasgiqplqnlsvlkqvgqenqmqwaqkvitsgfnalekilq
stagkycvgdevsmadvclvpqvanaerfkvdlspyptishinkellalevfqvshprrq
pdtpaelr
>d2cz3b2 a.45.1.1 (B:88-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
llpqdpqkraivrmisdliasgiqplqnenqmqwaqkvitsgfnalekilqstagkycvg
devsmadvclvpqvanaerfkvdlspyptishinkellalevfqvshprrqpdtpaelr
Timeline for d2cz3b2: