SCOPe 2.05: Domain d2cz3a2: 2cz3 A:88-215

Lineage for d2cz3a2 (2cz3 A:88-215)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (11 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225047] (2 PDB entries)

8. Domain d2cz3a2: 2cz3 A:88-215 [203849]
   Other proteins in same PDB: d2cz3a1, d2cz3b1
   automated match to d1fw1a1

Details for d2cz3a2

PDB Entry: 2cz3, 2.3 Å

PDB Description: Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from Mus musculus (form-2 crystal)

PDB Compounds: (A:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d2cz3a2:

Sequence; same for both SEQRES and ATOM records:

>d2cz3a2 a.45.1.1 (A:88-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
llpqdpqkraivrmisdliasgiqplqnlsvlkqvgqenqmqwaqkvitsgfnalekilq
stagkycvgdevsmadvclvpqvanaerfkvdlspyptishinkellalevfqvshprrq
pdtpaelr

Timeline for d2cz3a2:

• d2cz3a2 first appeared in SCOPe 2.03
  
• d2cz3a2 appears in SCOPe 2.04
  
• d2cz3a2 appears in SCOPe 2.06
  
• d2cz3a2 appears in the current release, SCOPe 2.08