![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein automated matches [226848] (14 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [225047] (2 PDB entries) |
![]() | Domain d2cz3a2: 2cz3 A:88-215 [203849] Other proteins in same PDB: d2cz3a1, d2cz3b1 automated match to d1fw1a1 |
PDB Entry: 2cz3 (more details), 2.3 Å
SCOPe Domain Sequences for d2cz3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cz3a2 a.45.1.1 (A:88-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]} llpqdpqkraivrmisdliasgiqplqnlsvlkqvgqenqmqwaqkvitsgfnalekilq stagkycvgdevsmadvclvpqvanaerfkvdlspyptishinkellalevfqvshprrq pdtpaelr
Timeline for d2cz3a2: