Lineage for d2cz3a1 (2cz3 A:4-87)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879989Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries)
  8. 2880002Domain d2cz3a1: 2cz3 A:4-87 [203848]
    Other proteins in same PDB: d2cz3a2, d2cz3b2
    automated match to d1fw1a2

Details for d2cz3a1

PDB Entry: 2cz3 (more details), 2.3 Å

PDB Description: Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from Mus musculus (form-2 crystal)
PDB Compounds: (A:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d2cz3a1:

Sequence, based on SEQRES records: (download)

>d2cz3a1 c.47.1.0 (A:4-87) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gkpilysyfrsscswrvrialalkgidyeivpinlikdggqqfteefqtlnpmkqvpalk
idgitivqslaimeyleetrpipr

Sequence, based on observed residues (ATOM records): (download)

>d2cz3a1 c.47.1.0 (A:4-87) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gkpilysyfrsscswrvrialalkgidyeivpiqvpalkidgitivqslaimeyleetrp
ipr

SCOPe Domain Coordinates for d2cz3a1:

Click to download the PDB-style file with coordinates for d2cz3a1.
(The format of our PDB-style files is described here.)

Timeline for d2cz3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cz3a2