SCOPe 2.03: Domain d2cwhb_: 2cwh B:

Lineage for d2cwhb_ (2cwh B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
   core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest

4. Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families)
   topological similarity to the domain 2 of TM1585
   automatically mapped to Pfam PF02615

5. Family c.122.1.0: automated matches [227150] (1 protein)
   not a true family

6. Protein automated matches [226854] (2 species)
   not a true protein

7. Species Pseudomonas syringae [TaxId:323] [225024] (3 PDB entries)

8. Domain d2cwhb_: 2cwh B: [203845]
   automated match to d1s20g_
   complexed with ndp, pyc

Details for d2cwhb_

PDB Entry: 2cwh, 1.7 Å

PDB Description: Crystal Structure of delta1-piperideine-2-carboxylate reductase from Pseudomonas syringae complexed with NADPH and pyrrole-2-carboxylate

PDB Compounds: (B:) delta1-piperideine-2-carboxylate reductase

SCOPe Domain Sequences for d2cwhb_:

Sequence; same for both SEQRES and ATOM records:

>d2cwhb_ c.122.1.0 (B:) automated matches {Pseudomonas syringae [TaxId: 323]}
dqptqtvsypqlidllrrifvvhgtspevadvlaencasaqrdgshshgifripgylssl
asgwvdgkavpvvedvgaafvrvdacngfaqpalaaarsllidkarsagvailairgshh
faalwpdvepfaeqglvalsmvnsmtcvvphgarqplfgtnpiafgapraggepivfdla
tsaiahgdvqiaaregrllpagmgvdrdglptqepraildggallpfgghkgsalsmmve
llaagltggnfsfefdwskhpgaqtpwtgqllividpdkgagqhfaqrseelvrqlhgvg
qerlpgdrrylerarsmahgiviaqadlerlqelagh

Timeline for d2cwhb_:

• d2cwhb_ is new in SCOPe 2.03-stable
  
• d2cwhb_ appears in SCOPe 2.04
  
• d2cwhb_ appears in the current release, SCOPe 2.08