![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily) core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest |
![]() | Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families) ![]() topological similarity to the domain 2 of TM1585 automatically mapped to Pfam PF02615 |
![]() | Family c.122.1.0: automated matches [227150] (1 protein) not a true family |
![]() | Protein automated matches [226854] (8 species) not a true protein |
![]() | Species Pseudomonas syringae [TaxId:323] [225024] (3 PDB entries) |
![]() | Domain d2cwfa_: 2cwf A: [203842] automated match to d1s20g_ complexed with ndp |
PDB Entry: 2cwf (more details), 1.8 Å
SCOPe Domain Sequences for d2cwfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwfa_ c.122.1.0 (A:) automated matches {Pseudomonas syringae [TaxId: 323]} tqtvsypqlidllrrifvvhgtspevadvlaencasaqrdgshshgifripgylsslasg wvdgkavpvvedvgaafvrvdacngfaqpalaaarsllidkarsagvailairgshhfaa lwpdvepfaeqglvalsmvnsmtcvvphgarqplfgtnpiafgapraggepivfdlatsa iahgdvqiaaregrllpagmgvdrdglptqepraildggallpfgghkgsalsmmvella agltggnfsfefdwskhpgaqtpwtgqllividpdkgagqhfaqrseelvrqlhgvgqer lpgdrrylerarsmahgiviaqadlerlqela
Timeline for d2cwfa_: