SCOPe 2.07: Domain d2cw3b2: 2cw3 B:91-203

Lineage for d2cw3b2 (2cw3 B:91-203)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (37 species)
   not a true protein

7. Species Perkinsus marinus [TaxId:31276] [225087] (2 PDB entries)

8. Domain d2cw3b2: 2cw3 B:91-203 [203841]
   Other proteins in same PDB: d2cw3a1, d2cw3b1
   automated match to d2nyba2
   complexed with fe

Details for d2cw3b2

PDB Entry: 2cw3, 2.5 Å

PDB Description: x-ray structure of pmsod2, superoxide dismutase from perkinsus marinus

PDB Compounds: (B:) iron superoxide dismutase

SCOPe Domain Sequences for d2cw3b2:

Sequence; same for both SEQRES and ATOM records:

>d2cw3b2 d.44.1.0 (B:91-203) automated matches {Perkinsus marinus [TaxId: 31276]}
tsgsgrhvpprllklirarwgnvdemkenfmrkatalfgsgwiwlvwdtrerrldlvgtk
dahsplsedagkiplftcdvwehayyldyqhdraayltrwwslinwefadsnl

Timeline for d2cw3b2:

• d2cw3b2 first appeared in SCOPe 2.03
  
• d2cw3b2 appears in SCOPe 2.06
  
• d2cw3b2 appears in the current release, SCOPe 2.08