Lineage for d2cw3b1 (2cw3 B:8-90)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980109Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1980386Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1980387Protein automated matches [226859] (32 species)
    not a true protein
  7. 1980501Species Perkinsus marinus [TaxId:31276] [225086] (2 PDB entries)
  8. 1980505Domain d2cw3b1: 2cw3 B:8-90 [203840]
    Other proteins in same PDB: d2cw3a2, d2cw3b2
    automated match to d1isca1
    complexed with fe

Details for d2cw3b1

PDB Entry: 2cw3 (more details), 2.5 Å

PDB Description: x-ray structure of pmsod2, superoxide dismutase from perkinsus marinus
PDB Compounds: (B:) iron superoxide dismutase

SCOPe Domain Sequences for d2cw3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cw3b1 a.2.11.0 (B:8-90) automated matches {Perkinsus marinus [TaxId: 31276]}
lrmtlpyglealepvisaatvdfhynkhhqgyiqklldatglpesrinlkslvtlgpdra
genvfnaagqiynhnmywlsmvp

SCOPe Domain Coordinates for d2cw3b1:

Click to download the PDB-style file with coordinates for d2cw3b1.
(The format of our PDB-style files is described here.)

Timeline for d2cw3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cw3b2