Lineage for d2cw3a2 (2cw3 A:91-203)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946473Species Perkinsus marinus [TaxId:31276] [225087] (2 PDB entries)
  8. 2946476Domain d2cw3a2: 2cw3 A:91-203 [203839]
    Other proteins in same PDB: d2cw3a1, d2cw3b1
    automated match to d2nyba2
    complexed with fe

Details for d2cw3a2

PDB Entry: 2cw3 (more details), 2.5 Å

PDB Description: x-ray structure of pmsod2, superoxide dismutase from perkinsus marinus
PDB Compounds: (A:) iron superoxide dismutase

SCOPe Domain Sequences for d2cw3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cw3a2 d.44.1.0 (A:91-203) automated matches {Perkinsus marinus [TaxId: 31276]}
tsgsgrhvpprllklirarwgnvdemkenfmrkatalfgsgwiwlvwdtrerrldlvgtk
dahsplsedagkiplftcdvwehayyldyqhdraayltrwwslinwefadsnl

SCOPe Domain Coordinates for d2cw3a2:

Click to download the PDB-style file with coordinates for d2cw3a2.
(The format of our PDB-style files is described here.)

Timeline for d2cw3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cw3a1