| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
| Protein automated matches [226859] (38 species) not a true protein |
| Species Perkinsus marinus [TaxId:31276] [225086] (2 PDB entries) |
| Domain d2cw3a1: 2cw3 A:4-90 [203838] Other proteins in same PDB: d2cw3a2, d2cw3b2 automated match to d1isca1 complexed with fe |
PDB Entry: 2cw3 (more details), 2.5 Å
SCOPe Domain Sequences for d2cw3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cw3a1 a.2.11.0 (A:4-90) automated matches {Perkinsus marinus [TaxId: 31276]}
pssglrmtlpyglealepvisaatvdfhynkhhqgyiqklldatglpesrinlkslvtlg
pdragenvfnaagqiynhnmywlsmvp
Timeline for d2cw3a1: