Lineage for d1dlfh_ (1dlf H:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) Species Anti-dansyl Fv, (mouse), kappa L chain [48882] (2 PDB entries) 
Domain d1dlfh_: 1dlf H: [20383]
Details for d1dlfh_
PDB Entry: 1dlf (more details), 1.45 Å
PDB Description: high resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 5.25
SCOP Domain Sequences for d1dlfh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlfh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Anti-dansyl Fv, (mouse), kappa L chain}
evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs
SCOP Domain Coordinates for d1dlfh_:
Click to download the PDB-style file with coordinates for d1dlfh_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dlfh_:
- d1dlfh_ appears in SCOP 1.57
- d1dlfh_ appears in the current release, SCOPe 2.08
View in 3D
