Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) duplication: contains two helix-hairpin-helix (HhH) motifs |
Family a.60.2.4: Topoisomerase V repeat domain [140626] (1 protein) this is a repeat family; one repeat unit is 2csb A:351-409 found in domain |
Protein Topoisomerase V [140627] (1 species) |
Species Methanopyrus kandleri [TaxId:2320] [140628] (2 PDB entries) Uniprot Q977W1 294-350! Uniprot Q977W1 351-409! Uniprot Q977W1 410-464! Uniprot Q977W1 465-519 |
Domain d2csda5: 2csd A:465-518 [203826] Other proteins in same PDB: d2csda1, d2csdb1 automated match to d2csba4 |
PDB Entry: 2csd (more details), 2.9 Å
SCOPe Domain Sequences for d2csda5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2csda5 a.60.2.4 (A:465-518) Topoisomerase V {Methanopyrus kandleri [TaxId: 2320]} pgyaslisirgidreraerllkkyggyskvreagveelredgltdaqirelkgl
Timeline for d2csda5: