Lineage for d2coja_ (2coj A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624092Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2624093Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2624094Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
  6. 2624193Protein automated matches [190187] (2 species)
    not a true protein
  7. 2624194Species Human (Homo sapiens) [TaxId:9606] [186926] (6 PDB entries)
  8. 2624201Domain d2coja_: 2coj A: [203820]
    automated match to d2abjd_
    complexed with gbn, mg, plp

Details for d2coja_

PDB Entry: 2coj (more details), 2.4 Å

PDB Description: crystal structure of reduced human cytosolic branched-chain aminotransferase complexed with gabapentin
PDB Compounds: (A:) branched chain aminotransferase 1, cytosolic

SCOPe Domain Sequences for d2coja_:

Sequence, based on SEQRES records: (download)

>d2coja_ e.17.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgtfkakdlivtpatilkekpdpnnlvfgtvftdhmltvewssefgwekphikplqnlsl
hpgssalhyavelfeglkafrgvdnkirlfqpnlnmdrmyrsavratlpvfdkeelleci
qqlvkldqewvpystsaslyirptfigtepslgvkkptkallfvllspvgpyfssgtfnp
vslwanpkyvrawkggtgdckmggnygsslfaqceavdngcqqvlwlygedhqitevgtm
nlflywinedgeeelatppldgiilpgvtrrcildlahqwgefkvseryltmddlttale
gnrvremfgsgtacvvcpvsdilykgetihiptmengpklasrilskltdiqygreerdw
tivl

Sequence, based on observed residues (ATOM records): (download)

>d2coja_ e.17.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgtfkakdlivtpatilkekpdpnlvfgtvftdhmltvewssefgwekphikplqnlslh
pgssalhyavelfeglkafrgvdnkirlfqpnlnmdrmyrsavratlpvfdkeelleciq
qlvkldqewvpystsaslyirptfigtepslgvkkptkallfvllspvgpyffnpvslwa
npkyvrawkggtgdckmggnygsslfaqceavdngcqqvlwlygedhqitevgtmnlfly
winedgeeelatppldgiilpgvtrrcildlahqwgefkvseryltmddlttalegnrvr
emfgsgtacvvcpvsdilykgetihiptmengpklasrilskltdiqygreerdwtivl

SCOPe Domain Coordinates for d2coja_:

Click to download the PDB-style file with coordinates for d2coja_.
(The format of our PDB-style files is described here.)

Timeline for d2coja_: