Lineage for d1dlfl_ (1dlf L:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7095Species Anti-dansyl Fv, (mouse), kappa L chain [48882] (2 PDB entries)
  8. 7097Domain d1dlfl_: 1dlf L: [20382]

Details for d1dlfl_

PDB Entry: 1dlf (more details), 1.45 Å

PDB Description: high resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 5.25

SCOP Domain Sequences for d1dlfl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlfl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Anti-dansyl Fv, (mouse), kappa L chain}
dvvmtqtplslpvslgnqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikr

SCOP Domain Coordinates for d1dlfl_:

Click to download the PDB-style file with coordinates for d1dlfl_.
(The format of our PDB-style files is described here.)

Timeline for d1dlfl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dlfh_