Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Anti-dansyl Fv, (mouse), kappa L chain [48882] (2 PDB entries) |
Domain d1dlfl_: 1dlf L: [20382] |
PDB Entry: 1dlf (more details), 1.45 Å
SCOP Domain Sequences for d1dlfl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlfl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Anti-dansyl Fv, (mouse), kappa L chain} dvvmtqtplslpvslgnqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikr
Timeline for d1dlfl_: