Lineage for d2coib_ (2coi B:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1453426Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1453427Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1453428Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
  6. 1453494Protein automated matches [190187] (1 species)
    not a true protein
  7. 1453495Species Human (Homo sapiens) [TaxId:9606] [186926] (6 PDB entries)
  8. 1453499Domain d2coib_: 2coi B: [203819]
    automated match to d2abjd_
    complexed with gbn, mg, plp

Details for d2coib_

PDB Entry: 2coi (more details), 1.9 Å

PDB Description: crystal structure of oxidized human cytosolic branched-chain aminotransferase complexed with gabapentin
PDB Compounds: (B:) branched chain aminotransferase 1, cytosolic

SCOPe Domain Sequences for d2coib_:

Sequence, based on SEQRES records: (download)

>d2coib_ e.17.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tfkakdlivtpatilkekpdpnnlvfgtvftdhmltvewssefgwekphikplqnlslhp
gssalhyavelfeglkafrgvdnkirlfqpnlnmdrmyrsavratlpvfdkeelleciqq
lvkldqewvpystsaslyirptfigtepslgvkkptkallfvllspvgpyfssgtfnpvs
lwanpkyvrawkggtgdckmggnygsslfaqceavdngcqqvlwlygedhqitevgtmnl
flywinedgeeelatppldgiilpgvtrrcildlahqwgefkvseryltmddlttalegn
rvremfgsgtacvvcpvsdilykgetihiptmengpklasrilskltdiqygreerdwti
vl

Sequence, based on observed residues (ATOM records): (download)

>d2coib_ e.17.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tfkakdlivtpatilkekpdpnlvfgtvftdhmltvewssefgwekphikplqnlslhpg
ssalhyavelfeglkafrgvdnkirlfqpnlnmdrmyrsavratlpvfdkeelleciqql
vkldqewvpystsaslyirptfigtepslgvkkptkallfvllspvgpyfnpvslwanpk
yvrawkggtgdckmggnygsslfaqceavdngcqqvlwlygedhqitevgtmnlflywin
edgeeelatppldgiilpgvtrrcildlahqwgefkvseryltmddlttalegnrvremf
gsgtacvvcpvsdilykgetihiptmengpklasrilskltdiqygreerdwtivl

SCOPe Domain Coordinates for d2coib_:

Click to download the PDB-style file with coordinates for d2coib_.
(The format of our PDB-style files is described here.)

Timeline for d2coib_: