SCOPe 2.08: Domain d2cmrl2: 2cmr L:107-207

Lineage for d2cmrl2 (2cmr L:107-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d2cmrl2: 2cmr L:107-207 [203814]
   Other proteins in same PDB: d2cmrh_, d2cmrl1
   automated match to d3fcta2
   complexed with gol

Details for d2cmrl2

PDB Entry: 2cmr, 2 Å

PDB Description: crystal structure of the hiv-1 neutralizing antibody d5 fab bound to the gp41 inner-core mimetic 5-helix

PDB Compounds: (L:) d5

SCOPe Domain Sequences for d2cmrl2:

Sequence; same for both SEQRES and ATOM records:

>d2cmrl2 b.1.1.2 (L:107-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtks

Timeline for d2cmrl2:

• d2cmrl2 first appeared in SCOPe 2.03
  
• d2cmrl2 appears in SCOPe 2.07