Lineage for d2cmrl1 (2cmr L:1-106A)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756019Domain d2cmrl1: 2cmr L:1-106A [203813]
    Other proteins in same PDB: d2cmrl2
    automated match to d3fcta1
    complexed with gol

Details for d2cmrl1

PDB Entry: 2cmr (more details), 2 Å

PDB Description: crystal structure of the hiv-1 neutralizing antibody d5 fab bound to the gp41 inner-core mimetic 5-helix
PDB Compounds: (L:) d5

SCOPe Domain Sequences for d2cmrl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmrl1 b.1.1.0 (L:1-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspstlsasigdrvtitcrasegiyhwlawyqqkpgkapklliykasslasgaps
rfsgsgsgtdftltisslqpddfatyycqqysnypltfgggtkleik

SCOPe Domain Coordinates for d2cmrl1:

Click to download the PDB-style file with coordinates for d2cmrl1.
(The format of our PDB-style files is described here.)

Timeline for d2cmrl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cmrl2
View in 3D
Domains from other chains:
(mouse over for more information)
d2cmrh_