Lineage for d2cmhb_ (2cmh B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865706Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1865707Protein automated matches [190689] (49 species)
    not a true protein
  7. 1865805Species Helicobacter pylori [TaxId:85962] [225261] (2 PDB entries)
  8. 1865809Domain d2cmhb_: 2cmh B: [203811]
    automated match to d1xj5b_

Details for d2cmhb_

PDB Entry: 2cmh (more details), 2.3 Å

PDB Description: Crystal Structure of Spermidine Synthase from Helicobacter Pylori
PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d2cmhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmhb_ c.66.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mwitqeitpylrkeytieaklldvrsehnileifkskdfgeiamlnrqllfknflhiese
llahmggctkkelkevlivdgfdlelahqlfkydthidfvqadekildsfisffphfhev
knnknfthakqlldldikkydlifclqepdihridglkrmlkedgvfisvakhpllehvs
mqnalknmggvfsvampfvaplrilsnkgyiyasfkthplkdlmtpkiealtsvryyned
ihraafalpknlqevfkdniks

SCOPe Domain Coordinates for d2cmhb_:

Click to download the PDB-style file with coordinates for d2cmhb_.
(The format of our PDB-style files is described here.)

Timeline for d2cmhb_: