Lineage for d1c12b1 (1c12 B:301-413)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287668Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (27 PDB entries)
  8. 287681Domain d1c12b1: 1c12 B:301-413 [20381]
    Other proteins in same PDB: d1c12a1, d1c12a2, d1c12b2
    part of antibody directed against the musk odorant traseolide
    complexed with trz

Details for d1c12b1

PDB Entry: 1c12 (more details), 2.6 Å

PDB Description: insight in odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide

SCOP Domain Sequences for d1c12b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c12b1 b.1.1.1 (B:301-413) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1}
qvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyisysgstsy
spslksrisltrdtsknqfflqlnsvttedtatyycvtsltwllrrkrsywgqgttvtvs
s

SCOP Domain Coordinates for d1c12b1:

Click to download the PDB-style file with coordinates for d1c12b1.
(The format of our PDB-style files is described here.)

Timeline for d1c12b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c12b2