Lineage for d1c12b1 (1c12 B:301-413)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52337Species Fab directed agains the musk odorant traseolide, (mouse), kappa L chain [48881] (1 PDB entry)
  8. 52339Domain d1c12b1: 1c12 B:301-413 [20381]
    Other proteins in same PDB: d1c12a2, d1c12b2

Details for d1c12b1

PDB Entry: 1c12 (more details), 2.6 Å

PDB Description: insight in odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide

SCOP Domain Sequences for d1c12b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c12b1 b.1.1.1 (B:301-413) Immunoglobulin (variable domains of L and H chains) {Fab directed agains the musk odorant traseolide, (mouse), kappa L chain}
qvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyisysgstsy
spslksrisltrdtsknqfflqlnsvttedtatyycvtsltwllrrkrsywgqgttvtvs
s

SCOP Domain Coordinates for d1c12b1:

Click to download the PDB-style file with coordinates for d1c12b1.
(The format of our PDB-style files is described here.)

Timeline for d1c12b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c12b2