SCOPe 2.03: Domain d2cmgb_: 2cmg B:

Lineage for d2cmgb_ (2cmg B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (42 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [225261] (2 PDB entries)

8. Domain d2cmgb_: 2cmg B: [203809]
   automated match to d1xj5b_

Details for d2cmgb_

PDB Entry: 2cmg, 2 Å

PDB Description: crystal structure of spermidine synthase from helicobacter pylori

PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d2cmgb_:

Sequence; same for both SEQRES and ATOM records:

>d2cmgb_ c.66.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mwitqeitpylrkeytieaklldvrsehnileifkskdfgeiamlnrqllfknflhiese
llahmggctkkelkevlivdgfdlelahqlfkydthidfvqadekildsfisffphfhev
knnknfthakqlldldikkydlifclqepdihridglkrmlkedgvfisvakhpllehvs
mqnalknmggvfsvampfvaplrilsnkgyiyasfkthplkdlmtpkiealtsvryyned
ihraafalpknlqevfkdniks

Timeline for d2cmgb_:

• d2cmgb_ is new in SCOPe 2.03-stable
  
• d2cmgb_ appears in SCOPe 2.04
  
• d2cmgb_ appears in the current release, SCOPe 2.08