Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (42 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [225261] (2 PDB entries) |
Domain d2cmgb_: 2cmg B: [203809] automated match to d1xj5b_ |
PDB Entry: 2cmg (more details), 2 Å
SCOPe Domain Sequences for d2cmgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cmgb_ c.66.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]} mwitqeitpylrkeytieaklldvrsehnileifkskdfgeiamlnrqllfknflhiese llahmggctkkelkevlivdgfdlelahqlfkydthidfvqadekildsfisffphfhev knnknfthakqlldldikkydlifclqepdihridglkrmlkedgvfisvakhpllehvs mqnalknmggvfsvampfvaplrilsnkgyiyasfkthplkdlmtpkiealtsvryyned ihraafalpknlqevfkdniks
Timeline for d2cmgb_: